PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0974s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 256aa    MW: 28808.9 Da    PI: 5.407
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0974s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.77.5e-4341372127
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratk 79 
                             ppG+rF Pt+eel+++yL++k++g +      ++++i+  diy+++PwdLp+     ++ ++ ++w+fF++r++++a+g r++r t+
  SapurV1A.0974s0010.1.p   4 PPGYRFFPTEEELISFYLHHKLDGGSeelnQVINKIIPVRDIYEHDPWDLPQisgdlNHIKDPEQWFFFIPRQESEARGGRPKRLTN 90 
                             9***********************9955533333457777***********6567653333567*********************** PP

                     NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                             +gyWkatg+  +v+s +++ +glk+t+vfy+grap+g+kt+W m+ey+
  SapurV1A.0974s0010.1.p  91 TGYWKATGSPGSVFS-NNRSIGLKRTMVFYNGRAPNGRKTEWKMNEYK 137
                             ***************.9999***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-462166IPR003441NAC domain
PROSITE profilePS5100547.3783166IPR003441NAC domain
PfamPF023657.5E-224137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVFPPGYRFF PTEEELISFY LHHKLDGGSE ELNQVINKII PVRDIYEHDP WDLPQISGDL  60
NHIKDPEQWF FFIPRQESEA RGGRPKRLTN TGYWKATGSP GSVFSNNRSI GLKRTMVFYN  120
GRAPNGRKTE WKMNEYKAID QGEASSSTRA NPKLRHEYSL CRVYKSSKCL RSFDRRPVGL  180
EVAEPRAQPA SGGNELAAPD QNHPIVDNTG SPESSCSGDL GDPSRTGESS SMPMSIDNDD  240
AWDVELDWYY SAGQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-35116515164NO APICAL MERISTEM PROTEIN
1ut4_B9e-35116515164NO APICAL MERISTEM PROTEIN
1ut7_A9e-35116515164NO APICAL MERISTEM PROTEIN
1ut7_B9e-35116515164NO APICAL MERISTEM PROTEIN
3swm_A1e-34116518167NAC domain-containing protein 19
3swm_B1e-34116518167NAC domain-containing protein 19
3swm_C1e-34116518167NAC domain-containing protein 19
3swm_D1e-34116518167NAC domain-containing protein 19
3swp_A1e-34116518167NAC domain-containing protein 19
3swp_B1e-34116518167NAC domain-containing protein 19
3swp_C1e-34116518167NAC domain-containing protein 19
3swp_D1e-34116518167NAC domain-containing protein 19
4dul_A9e-35116515164NAC domain-containing protein 19
4dul_B9e-35116515164NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011004699.11e-170PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR36e-68NAC90_ARATH; NAC domain-containing protein 90
TrEMBLB9IIS21e-167B9IIS2_POPTR; Uncharacterized protein
STRINGPOPTR_0016s07690.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-69NAC domain containing protein 90